PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31600.1.p
Common NameBRADI_2g31600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 773aa    MW: 83399.8 Da    PI: 6.3103
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.61.6e-1670120656
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++ +eq+++Le++F+++++p+++ r +L+k+lg+   qVk+WFqNrR  +k
  Bradi2g31600.1.p  70 RHRREQIQQLEAVFQQCPHPDEQLRLDLSKRLGMGLLQVKFWFQNRRSAKK 120
                       5679*******************************************9887 PP

2START86.46.4e-282664959205
                       HHHHHH.HHC-TT-EEEE..........EXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT.. CS
             START   9 elvkka.laeepgWvkss..........esengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg.. 88 
                       e++k++ + +ep+W + s          ++ +++  l + +++  + ++  r++g+v +++a+l ++++d + +W+e+++ + +  v ss+  
  Bradi2g31600.1.p 266 EEFKMIaSMNEPMWLRTSdgdvlnnqayKNATYPGILGICPKG--FAVDGTRTTGIVLGNAADLTSIFMDPA-RWSEMFPGIIVAGVTSSAii 355
                       556665156899***9999955555555555555555555442..79***************9999999999.*******5555555555566 PP

                       .........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE....-TTS--..........-TTSEE-EESSEEEEEEEEC CS
             START  89 .........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd....seqkppe.........sssvvRaellpSgiliepks 158
                                  l++m+ael +l p +p   + f R++ +l+   w++vdvSvd    ++++++             +   +llpSg++ie+++
  Bradi2g31600.1.p 356 nssasqprlVQLVQMSAELKVLAPRAPvVRVRFMRQCMRLQPRLWAVVDVSVDgfigHNDEKTLdlyqtaaalPTMYTAYRLLPSGCIIEEMD 448
                       666777*9999**********888888777888888888*************9777777777766655434322234555899********** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       +gh+kvt + h++++++ ++ l+++l++sg+a+ga++w+a lqrq e
  Bradi2g31600.1.p 449 DGHCKVTCIVHAEYDESNIQPLFHPLLRSGQAFGARRWLASLQRQSE 495
                       ********************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1642125IPR009057Homeodomain-like
PROSITE profilePS5007114.80362122IPR001356Homeobox domain
SMARTSM003892.8E-1564126IPR001356Homeobox domain
SuperFamilySSF466892.31E-1564124IPR009057Homeodomain-like
CDDcd000861.01E-1565123No hitNo description
PfamPF000463.3E-1470120IPR001356Homeobox domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
CDDcd146867.93E-5113150No hitNo description
PROSITE profilePS5084824.897250499IPR002913START domain
SuperFamilySSF559615.44E-14259495No hitNo description
PfamPF018524.1E-22265495IPR002913START domain
SuperFamilySSF559613.5E-7517739No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MDGEGQQGSS DHNIELDFSD DNNLGDETDG VSYEPNTDDD ANAAAANEDS NAGGGGAAAA  60
GRTAPRSSKR HRREQIQQLE AVFQQCPHPD EQLRLDLSKR LGMGLLQVKF WFQNRRSAKK  120
NKMEQQEGKK LREENEMLLA ENKAMKAEIQ SRTCIGCGGP RMHIHDCRDT PEKQRLRMEN  180
AMLKDQLMRT KVFVSVLTGK DVDDAAAAAE EGALPAAYSP YGLNNGGRPL VINPAAAVPA  240
PSMSSAARSI AASQITLLDH LIGACEEFKM IASMNEPMWL RTSDGDVLNN QAYKNATYPG  300
ILGICPKGFA VDGTRTTGIV LGNAADLTSI FMDPARWSEM FPGIIVAGVT SSAIINSSAS  360
QPRLVQLVQM SAELKVLAPR APVVRVRFMR QCMRLQPRLW AVVDVSVDGF IGHNDEKTLD  420
LYQTAAALPT MYTAYRLLPS GCIIEEMDDG HCKVTCIVHA EYDESNIQPL FHPLLRSGQA  480
FGARRWLASL QRQSEYFAVL RSDLVLNLNN TGAAMKPAGK KGILELAQRM TMNFYVAMCG  540
LPAGQPWNDW NGGIGVGSER FELAVHFVTL DHQGVLSATT TVWLPGVPAG RVFHYLCDGS  600
RRGEWDSLAS SGPMKEVACV ATGQLYGNSV SVLRPSVYNG TTNKNDKLIL QEAYADASCM  660
FMAYAPIDKQ SMHQVMNGGG HTSFSLSPCG FIVLPDGQGQ QSVQTISAGS SSSAGVSATC  720
AGSIVSALYQ TELSAPLQQS VAIGLMDDIG NLFCHAIKKI KDAVQAKLVV PA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120RRSAKKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754067.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
TrEMBLI1HKQ60.0I1HKQ6_BRADI; Uncharacterized protein
STRINGBRADI2G31600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-119HD-ZIP family protein